International law enforcement operation disrupts Shylock banking malware

Police in eight countries worked with security vendors to seize domain names and servers used by the Trojan program

Police from eight countries together with several private security companies disrupted the online infrastructure used by cybercriminals to control computers infected with a malware program called Shylock.

Shylock is a Trojan program that first appeared in 2011, primarily targeting online banking. The threat is named after a fictional character in Shakespeare's "The Merchant of Venice" because it includes fragments from the play in its binary files.

Like most malware programs that steal financial information, Shylock is able to inject code into websites in order to capture credentials and trick victims into performing rogue financial transactions. However, the Trojan program has evolved over the years, with its creators adding modules so that it can infect external and USB drives, steal credentials from FTP programs and turn infected computers into proxy servers, among other things.

Security vendor Symantec reported in April 2013 that Shylock was targeting customers of over 60 financial institutions, the majority of them from the U.K., and some from Italy and the U.S.

The law enforcement operation Tuesday and Wednesday seized servers and domain names used by Shylock-infected computers to communicate with each other and the attackers.

The action was led by the U.K.'s National Crime Agency (NCA) and was coordinated from the European Cybercrime Centre (EC3) at Europol. Law enforcement agencies from the U.K., the U.S., the Netherlands, Turkey, Italy, Germany, Poland and France participated. Several IT security vendors, including BAE Systems Applied Intelligence, Dell SecureWorks, Kaspersky Lab and Heimdal Security (part of CSIS Security Group), provided support.

Shylock is believed to have infected over 30,000 computers worldwide, the NCA said in an announcement. The Trojan program has targeted the U.K. more than any other country, but the suspected developers are based somewhere else, the agency said.

Users typically have their computers infected with Shylock after clicking on malicious links that take them to drive-by download exploits or after inserting infected removable drives into their computers.

The NCA and Europol advised users to turn on automatic updates in Windows in order to protect themselves from Shylock. That's because Tuesday Microsoft added detection and removal routines for the threat, which it calls Win32/Caphaw, to its Malicious Software Removal Tool (MSRT). The tool is distributed through Windows Update, but users can also download it directly from the company's website.

Read more: Effective MSS about more than alert monitoring: new Dell SecureWorks head

Join the newsletter!

Error: Please check your email address.
Rocket to Success - Your 10 Tips for Smarter ERP System Selection

Tags securityfraudcybercrimemalwarelegalspywarekaspersky labBAE SystemsEuropolDell SecureWorksNational Crime Agency

Keep up with the latest tech news, reviews and previews by subscribing to the Good Gear Guide newsletter.

Lucian Constantin

IDG News Service
Show Comments

Cool Tech

SanDisk MicroSDXC™ for Nintendo® Switch™

Learn more >

Breitling Superocean Heritage Chronographe 44

Learn more >

Toys for Boys

Family Friendly

Panasonic 4K UHD Blu-Ray Player and Full HD Recorder with Netflix - UBT1GL-K

Learn more >

Stocking Stuffer

Razer DeathAdder Expert Ergonomic Gaming Mouse

Learn more >

Christmas Gift Guide

Click for more ›

Most Popular Reviews

Latest Articles

Resources

PCW Evaluation Team

Edwina Hargreaves

WD My Cloud Home

I would recommend this device for families and small businesses who want one safe place to store all their important digital content and a way to easily share it with friends, family, business partners, or customers.

Walid Mikhael

Brother QL-820NWB Professional Label Printer

It’s easy to set up, it’s compact and quiet when printing and to top if off, the print quality is excellent. This is hands down the best printer I’ve used for printing labels.

Ben Ramsden

Sharp PN-40TC1 Huddle Board

Brainstorming, innovation, problem solving, and negotiation have all become much more productive and valuable if people can easily collaborate in real time with minimal friction.

Sarah Ieroianni

Brother QL-820NWB Professional Label Printer

The print quality also does not disappoint, it’s clear, bold, doesn’t smudge and the text is perfectly sized.

Ratchada Dunn

Sharp PN-40TC1 Huddle Board

The Huddle Board’s built in program; Sharp Touch Viewing software allows us to easily manipulate and edit our documents (jpegs and PDFs) all at the same time on the dashboard.

George Khoury

Sharp PN-40TC1 Huddle Board

The biggest perks for me would be that it comes with easy to use and comprehensive programs that make the collaboration process a whole lot more intuitive and organic

Featured Content

Product Launch Showcase

Latest Jobs

Don’t have an account? Sign up here

Don't have an account? Sign up now

Forgot password?