International law enforcement operation disrupts Shylock banking malware

Police in eight countries worked with security vendors to seize domain names and servers used by the Trojan program

Police from eight countries together with several private security companies disrupted the online infrastructure used by cybercriminals to control computers infected with a malware program called Shylock.

Shylock is a Trojan program that first appeared in 2011, primarily targeting online banking. The threat is named after a fictional character in Shakespeare's "The Merchant of Venice" because it includes fragments from the play in its binary files.

Like most malware programs that steal financial information, Shylock is able to inject code into websites in order to capture credentials and trick victims into performing rogue financial transactions. However, the Trojan program has evolved over the years, with its creators adding modules so that it can infect external and USB drives, steal credentials from FTP programs and turn infected computers into proxy servers, among other things.

Security vendor Symantec reported in April 2013 that Shylock was targeting customers of over 60 financial institutions, the majority of them from the U.K., and some from Italy and the U.S.

The law enforcement operation Tuesday and Wednesday seized servers and domain names used by Shylock-infected computers to communicate with each other and the attackers.

The action was led by the U.K.'s National Crime Agency (NCA) and was coordinated from the European Cybercrime Centre (EC3) at Europol. Law enforcement agencies from the U.K., the U.S., the Netherlands, Turkey, Italy, Germany, Poland and France participated. Several IT security vendors, including BAE Systems Applied Intelligence, Dell SecureWorks, Kaspersky Lab and Heimdal Security (part of CSIS Security Group), provided support.

Shylock is believed to have infected over 30,000 computers worldwide, the NCA said in an announcement. The Trojan program has targeted the U.K. more than any other country, but the suspected developers are based somewhere else, the agency said.

Users typically have their computers infected with Shylock after clicking on malicious links that take them to drive-by download exploits or after inserting infected removable drives into their computers.

The NCA and Europol advised users to turn on automatic updates in Windows in order to protect themselves from Shylock. That's because Tuesday Microsoft added detection and removal routines for the threat, which it calls Win32/Caphaw, to its Malicious Software Removal Tool (MSRT). The tool is distributed through Windows Update, but users can also download it directly from the company's website.

Read more: Effective MSS about more than alert monitoring: new Dell SecureWorks head

Join the newsletter!

Or

Sign up to gain exclusive access to email subscriptions, event invitations, competitions, giveaways, and much more.

Membership is free, and your security and privacy remain protected. View our privacy policy before signing up.

Error: Please check your email address.

Tags fraudcybercrimemalwarelegalspywarekaspersky labBAE SystemsEuropolDell SecureWorksNational Crime Agency

Keep up with the latest tech news, reviews and previews by subscribing to the Good Gear Guide newsletter.
Lucian Constantin

Lucian Constantin

IDG News Service
Show Comments

Brand Post

Most Popular Reviews

Latest Articles

Resources

PCW Evaluation Team

Jack Jeffries

MSI GS75

As the Maserati or BMW of laptops, it would fit perfectly in the hands of a professional needing firepower under the hood, sophistication and class on the surface, and gaming prowess (sports mode if you will) in between.

Taylor Carr

MSI PS63

The MSI PS63 is an amazing laptop and I would definitely consider buying one in the future.

Christopher Low

Brother RJ-4230B

This small mobile printer is exactly what I need for invoicing and other jobs such as sending fellow tradesman details or step-by-step instructions that I can easily print off from my phone or the Web.

Aysha Strobbe

Microsoft Office 365/HP Spectre x360

Microsoft Office continues to make a student’s life that little bit easier by offering reliable, easy to use, time-saving functionality, while continuing to develop new features that further enhance what is already a formidable collection of applications

Michael Hargreaves

Microsoft Office 365/Dell XPS 15 2-in-1

I’d recommend a Dell XPS 15 2-in-1 and the new Windows 10 to anyone who needs to get serious work done (before you kick back on your couch with your favourite Netflix show.)

Maryellen Rose George

Brother PT-P750W

It’s useful for office tasks as well as pragmatic labelling of equipment and storage – just don’t get too excited and label everything in sight!

Featured Content

Product Launch Showcase

Don’t have an account? Sign up here

Don't have an account? Sign up now

Forgot password?